Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKKSKVAKELKRQQLVEQYAGIRRELKEKGDYEALSKLPRDSAPGRLHNRCMVTGRPRAYMRKFKMSRIAFRELAHKGQIPGVKKASW 4DR2 Chain:N ((19-61)) ----------------------------------------------RAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW

General information: TITO was launched using: RESULT: Template: 4DR2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 113 -26550 -234.96 -617.44 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain N : 0.75 3D Compatibility (PKB) : -234.96 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.692

(partial model without unconserved sides chains): PDB file : Tito_4DR2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4DR2-query.scw PDB file : Tito_Scwrl_4DR2.pdb: