Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
5E4W Chain:A ((3-106))--IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL


General information:
TITO was launched using:
RESULT:

Template: 5E4W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 426 5171 12.14 50.69
target 2D structure prediction score : 0.80
Monomeric hydrophicity matching model chain A : 0.86

3D Compatibility (PKB) : 12.14
2D Compatibility (Sec. Struct. Predict.) : 0.80
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.664

(partial model without unconserved sides chains):
PDB file : Tito_5E4W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5E4W-query.scw
PDB file : Tito_Scwrl_5E4W.pdb: