Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGDSETPLVLMGYFNPIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVAGVTGAN---AATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVV-GSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR
1C8V Chain:A ((2-253))-ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRG--PLHHLIE---KLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEK---NLASPKQMLAELRSFVSAMKAAS


General information:
TITO was launched using:
RESULT:

Template: 1C8V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -136423 for 2045 contacts (-66.7/contact) +
2D Compatibility (PS) -28394 + (NN) -22022 + (LL) 1144
1D Compatibility (HY) -16000 + (ID) 4750
Total energy: -206445.0 ( -100.95 by residue)
QMean score : 0.518

(partial model without unconserved sides chains):
PDB file : Tito_1C8V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1C8V-query.scw
PDB file : Tito_Scwrl_1C8V.pdb: