Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRAELAVYFIAGTQDIVRGTLPSVLEEALKGGITCFQYREKGAGSLQTASERKEMALECQKLCAKYQVPFIINDDVALALEIGADGIHVGQTDEAIRQVIASCSGKMKIGLSVHSVSEAKEAERLGAVDYIGVGPIFPTISKADAEPVSGTAILEEIRRAG-ITIPIVGIGGINETNSAEVLTAGADGVSVISAITQSDDCHSVIKQLKNPGSPS
2TPS Chain:A ((14-220))MKELLSVYFIMGSNNTK-ADPVTVVQKALKGGATLYQFREKGGDAL-TGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAI-GDMILGVSAHTMSEVKQAEEDGA-DYVGLGPIYPTETKKDTRAVQGVSLIEAVRR-QGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEI---


General information:
TITO was launched using:
RESULT:

Template: 2TPS.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -130115 for 1767 contacts (-73.6/contact) +
2D Compatibility (PS) -23357 + (NN) -17786 + (LL) 332
1D Compatibility (HY) -14800 + (ID) 5000
Total energy: -190726.0 ( -107.94 by residue)
QMean score : 0.689

(partial model without unconserved sides chains):
PDB file : Tito_2TPS.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2TPS-query.scw
PDB file : Tito_Scwrl_2TPS.pdb: