Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 3QP6 Chain:A ((194-259)) -------SNMPLSQREYDIFHWMSRGKTNWEIATILNISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMTP-

General information: TITO was launched using: RESULT: Template: 3QP6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -28851 -121.22 -437.14 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -121.22 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.690

(partial model without unconserved sides chains): PDB file : Tito_3QP6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QP6-query.scw PDB file : Tito_Scwrl_3QP6.pdb: