Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceVAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIAFGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTH-LHRTIQLIKSYGVRAGVVLNPGTPPSTLEYVLD---DIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIGNRPIQIEVDGGVNDELAKECTLAGADLIVVGSYLFEGD-IEANLEKLAKGVLTE
1H1Y Chain:A ((7-223))-AKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKY--PSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEG-


General information:
TITO was launched using:
RESULT:

Template: 1H1Y.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -169964 for 1855 contacts (-91.6/contact) +
2D Compatibility (PS) -23392 + (NN) -16464 + (LL) 44
1D Compatibility (HY) -16000 + (ID) 3950
Total energy: -229726.0 ( -123.84 by residue)
QMean score : 0.698

(partial model without unconserved sides chains):
PDB file : Tito_1H1Y.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1H1Y-query.scw
PDB file : Tito_Scwrl_1H1Y.pdb: