Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK 3ZTE Chain:C ((10-77)) -------DFVVIKAVEDGVNVIGLTRGTDTRFHHSEKLDKGEVMICQFTEHTSAIKVRGEALIQTANGEMKSESK

General information: TITO was launched using: RESULT: Template: 3ZTE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 278 -17588 -63.27 -258.65 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain C : 0.95 3D Compatibility (PKB) : -63.27 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.95 QMean score : 0.686

(partial model without unconserved sides chains): PDB file : Tito_3ZTE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZTE-query.scw PDB file : Tito_Scwrl_3ZTE.pdb: