Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
2H75 Chain:B ((4-107))--IIHLTDDSFETDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL


General information:
TITO was launched using:
RESULT:

Template: 2H75.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 441 13549 30.72 132.83
target 2D structure prediction score : 0.84
Monomeric hydrophicity matching model chain B : 0.86

3D Compatibility (PKB) : 30.72
2D Compatibility (Sec. Struct. Predict.) : 0.84
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.637

(partial model without unconserved sides chains):
PDB file : Tito_2H75.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2H75-query.scw
PDB file : Tito_Scwrl_2H75.pdb: