Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLPLHISLEKKKVVIAGGGSIALRRLKTVISEGADITLVSPDVEPEIKQMAEERRIKWEKRTI------EKEDYLNAFFIIAATDN-AAVNKEIAQSASP-FQLVNCVSDAELGNVYMPKIVKRGHVTVSVSTSGASPKHTKELAENVDKLIDGDFVAEVNRLYQMRRKK 4J91 Chain:A ((8-107)) -----------QFAVIGLGRFGGSICKELHRMGHEVLAVDINEEK-VNAYAS-YATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDI-------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4J91.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 363 -65105 -179.35 -793.96 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -179.35 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.651

(partial model without unconserved sides chains): PDB file : Tito_4J91.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J91-query.scw PDB file : Tito_Scwrl_4J91.pdb: