Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA 4HZU Chain:S ((139-164)) ---------------------------------------------------------GNVVQVGFGAGVTLSIVGPLTRLKPD--

General information: TITO was launched using: RESULT: Template: 4HZU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 3 -313 -104.17 -12.02 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain S : 0.44 3D Compatibility (PKB) : -104.17 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.44 QMean score : 0.683

(partial model without unconserved sides chains): PDB file : Tito_4HZU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HZU-query.scw PDB file : Tito_Scwrl_4HZU.pdb: