Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD 3BLJ Chain:A ((90-138)) --------------KNDHKNNERLLFHGTDADSVPYVNQHGFN-----------RSCA-----SYGKGTYFAVD

General information: TITO was launched using: RESULT: Template: 3BLJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 64 -7452 -116.44 -169.36 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -116.44 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.267

(partial model without unconserved sides chains): PDB file : Tito_3BLJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BLJ-query.scw PDB file : Tito_Scwrl_3BLJ.pdb: