Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKG-NEAEVIQIMSTNPM-HFLHPDISPGQKLKLNV 4AYB Chain:H ((31-65)) ---------------------------------ILKELGIRPEQLPWIRASDPVARSIN--AKPGDIIRI--

General information: TITO was launched using: RESULT: Template: 4AYB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 51 -9111 -178.64 -276.08 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain H : 0.61 3D Compatibility (PKB) : -178.64 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.098

(partial model without unconserved sides chains): PDB file : Tito_4AYB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4AYB-query.scw PDB file : Tito_Scwrl_4AYB.pdb: