Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVKTWEEFLKQEAKQPYFIELMEAVKDARAKG-NVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNIYKELKTDL-DIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLEEHERKPIDWDLNEQ
1FLZ Chain:A ((5-219))---TWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDW-----


General information:
TITO was launched using:
RESULT:

Template: 1FLZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -118462 for 1756 contacts (-67.5/contact) +
2D Compatibility (PS) -22731 + (NN) -9551 + (LL) 708
1D Compatibility (HY) -22000 + (ID) 5350
Total energy: -177386.0 ( -101.02 by residue)
QMean score : 0.640

(partial model without unconserved sides chains):
PDB file : Tito_1FLZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1FLZ-query.scw
PDB file : Tito_Scwrl_1FLZ.pdb: