Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN 4OGQ Chain:H ((5-25)) ---------------------------------------------------TLGWVSLLVVFTWSIAMVVWG----------

General information: TITO was launched using: RESULT: Template: 4OGQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 3 -445 -148.17 -21.17 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain H : 0.48 3D Compatibility (PKB) : -148.17 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.265

(partial model without unconserved sides chains): PDB file : Tito_4OGQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OGQ-query.scw PDB file : Tito_Scwrl_4OGQ.pdb: