Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQDLYQLIGEKLNDIIPGEWTKIYLYAEVLDDSTMVLFHFRTPENNQIIYSQDIPSHYNVSKDIFKTLLRELRELFEELRTEHRNNNDDVWTNLTLTLDRSGEFQLDYNYDDILASELDGYERIAIWEYKNLGILPEDEDDKEFVISYLGL 1O9K Chain:B ((17-79)) -------------------------------------------------------------KKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKV---------------------------

General information: TITO was launched using: RESULT: Template: 1O9K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 153 -39731 -259.68 -630.64 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -259.68 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.485

(partial model without unconserved sides chains): PDB file : Tito_1O9K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1O9K-query.scw PDB file : Tito_Scwrl_1O9K.pdb: