Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQKLGHKQADSILTLLKLANEKHITL 5BWA Chain:B ((59-100)) ----------------------------------------RINWRTVLSGGSLYIEIPGG----AL--PEGSKD--SFAVLLEFAEEQ----

General information: TITO was launched using: RESULT: Template: 5BWA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 78 -9968 -127.79 -249.20 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain B : 0.62 3D Compatibility (PKB) : -127.79 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.444

(partial model without unconserved sides chains): PDB file : Tito_5BWA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5BWA-query.scw PDB file : Tito_Scwrl_5BWA.pdb: