Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSYRQMLIHRCDIYHEAAQAPSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLIQEEPDQTVYHSFLVHFPLSADIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDESL 2AUT Chain:A ((112-174)) -----FVTGRSQTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTNVQWLQEKNMRIFYGDSDNDI--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2AUT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 144 -10405 -72.25 -165.15 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -72.25 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.237

(partial model without unconserved sides chains): PDB file : Tito_2AUT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AUT-query.scw PDB file : Tito_Scwrl_2AUT.pdb: