Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKGKIPKIRNQANKVKRTPRYMEFPVTYEVYHVESGDTLWTIAKSFEIPVQQLMNLNKL-SSDRIYPGQIIKIRER 5C8Q Chain:B ((63-103)) --------------------------------VQQGDTLRDIGRRFDCDFHEIARRNNIQNEDLIYPGQVLQV---

General information: TITO was launched using: RESULT: Template: 5C8Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 111 -26337 -237.27 -658.43 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.72 3D Compatibility (PKB) : -237.27 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.687

(partial model without unconserved sides chains): PDB file : Tito_5C8Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5C8Q-query.scw PDB file : Tito_Scwrl_5C8Q.pdb: