Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKIAKVGNVIEFKNGLTGVVEKVNENS-VIVDVTIMDNYRDLELDSLTVVNHKNYKIIRDSY 2K0Z Chain:A ((9-49)) -------------------LEEVNFNDFIVVDVRELDEYEELHLPNATLISVNDQEKLAD--

General information: TITO was launched using: RESULT: Template: 2K0Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 89 -4399 -49.42 -109.96 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -49.42 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.325

(partial model without unconserved sides chains): PDB file : Tito_2K0Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K0Z-query.scw PDB file : Tito_Scwrl_2K0Z.pdb: