Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADSFLFYNLSEAQMTFQDVMERLKAFVQKDPRSSYVLSIGTDSQVYRDYTKFITALHLHRTGKGAWGCLKNHTVDRPIHSLREKISLETAYSQETAAHILDGHLMDITDLLLPFTGEGADLTFEVHLDIGKKGLTKDLIQEMTGRITSMGIEAKIKPDSYTAFSYANRFTK 4CF4 Chain:A ((51-108)) ---------------------------------------------------------------------------------------------------ILYSQTLTLTGLYRPF-GEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAP--------------

General information: TITO was launched using: RESULT: Template: 4CF4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 96 -12276 -127.87 -211.65 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -127.87 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.141

(partial model without unconserved sides chains): PDB file : Tito_4CF4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4CF4-query.scw PDB file : Tito_Scwrl_4CF4.pdb: