Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDRKKDEIQRKYREQMREKKEREKEDGSSHTFEIVVVLA--IIILMFFFNSVFKAF 2WWB Chain:C ((70-92)) -------------------------------PVPVLVMSLLFIASVFMLHIWGK--

General information: TITO was launched using: RESULT: Template: 2WWB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 6 -2101 -350.17 -100.05 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain C : 0.76 3D Compatibility (PKB) : -350.17 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.588

(partial model without unconserved sides chains): PDB file : Tito_2WWB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WWB-query.scw PDB file : Tito_Scwrl_2WWB.pdb: