Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 1WG3 Chain:A ((114-157)) -----------------VRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFN-----------

General information: TITO was launched using: RESULT: Template: 1WG3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 78 -815 -10.45 -18.52 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -10.45 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.055

(partial model without unconserved sides chains): PDB file : Tito_1WG3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WG3-query.scw PDB file : Tito_Scwrl_1WG3.pdb: