Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTVMTVINSGYPTAH 3O0Y Chain:A ((433-445)) --------------------------------------------KTLTYHEANPGHH

General information: TITO was launched using: RESULT: Template: 3O0Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 12 -741 -61.75 -57.00 target 2D structure prediction score : 0.92 Monomeric hydrophicity matching model chain A : 0.34 3D Compatibility (PKB) : -61.75 2D Compatibility (Sec. Struct. Predict.) : 0.92 1D Compatibility (Hydrophobicity) : 0.34 QMean score : 0.454

(partial model without unconserved sides chains): PDB file : Tito_3O0Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3O0Y-query.scw PDB file : Tito_Scwrl_3O0Y.pdb: