Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCLKDV---S-LLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF 5DA0 Chain:A ((317-386)) ----------------------------------------QPLLVQIPMAALVAVMMVVAISTFDWGSLR---FPKGETVVMLATVAVTVFTHDLSLGVLIGVVLSALF-----

General information: TITO was launched using: RESULT: Template: 5DA0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 66 -8432 -127.75 -135.99 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -127.75 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.152

(partial model without unconserved sides chains): PDB file : Tito_5DA0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DA0-query.scw PDB file : Tito_Scwrl_5DA0.pdb: