Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSKLSILMIGFALSVLLAACGSNDAKEEKTDTGSKTEATASEGEELYQQSCVGCHGKDLEGVSGPNLQEVGGKYDEHKIESIIKNGRGNMP---KGLVDDNEAAVIAKWLSEKK 1DII Chain:C ((2-74)) --------------------------------------SQWGSGKNLYDKVCGHCHKPEVG--VGPVLE--GRGLPEAYIKDIVRNGFRAMPAFPASYVDDESLTQVAEYLSSLP

General information: TITO was launched using: RESULT: Template: 1DII.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 249 -6741 -27.07 -96.30 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -27.07 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.537

(partial model without unconserved sides chains): PDB file : Tito_1DII.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DII-query.scw PDB file : Tito_Scwrl_1DII.pdb: