Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEMGRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEELGLRLDGVINIKVDPSCLIERLSGRIINRKTGETFHKVFNPPV-----DYKEEDYYQREDDKPETVKRRLDVNIAQGEPILEHYRKLGLVTD-----IEGNQEITEVFADVEKALLELK
4JZK Chain:B ((1-213))MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQED-CRNGFLLDGFPRTIPQADA----MKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG---


General information:
TITO was launched using:
RESULT:

Template: 4JZK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -44636 for 1588 contacts (-28.1/contact) +
2D Compatibility (PS) -22089 + (NN) -10043 + (LL) 956
1D Compatibility (HY) -16000 + (ID) 4350
Total energy: -96162.0 ( -60.56 by residue)
QMean score : 0.480

(partial model without unconserved sides chains):
PDB file : Tito_4JZK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4JZK-query.scw
PDB file : Tito_Scwrl_4JZK.pdb: