Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW
4AQY Chain:N ((1-60))-ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW


General information:
TITO was launched using:
RESULT:

Template: 4AQY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -26470 for 322 contacts (-82.2/contact) +
2D Compatibility (PS) -5988 + (NN) -1780 + (LL) 208
1D Compatibility (HY) -7200 + (ID) 2100
Total energy: -43330.0 ( -134.57 by residue)
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_4AQY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4AQY-query.scw
PDB file : Tito_Scwrl_4AQY.pdb: