Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIGVKPGNVAAALSGLGELVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGFEYNLVLIAVSIGVALIGSGAYALHF 2LZR Chain:A ((13-24)) ----------------------------------------------------------------------------------------------------------------AVIVVLLFGPKK-----

General information: TITO was launched using: RESULT: Template: 2LZR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 83 41.25 6.88 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.37 3D Compatibility (PKB) : 41.25 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.37 QMean score : 0.460

(partial model without unconserved sides chains): PDB file : Tito_2LZR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LZR-query.scw PDB file : Tito_Scwrl_2LZR.pdb: