Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKAWKVEPYEISKAMELIYKYLLLDKKDFSLEEFYKLTIYAIKWKLEQAQFPLYLESTKKSHQNVIPQPFKIKGNV-LYKTVIKNSGDFEE 1T6A Chain:A ((33-73)) -------------------------------------TGEQLGWAYEQAAFPYTVRIHE--------SVLYLQGDGRLYKGMAISV-----

General information: TITO was launched using: RESULT: Template: 1T6A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 69 -6204 -89.91 -155.09 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -89.91 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.358

(partial model without unconserved sides chains): PDB file : Tito_1T6A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1T6A-query.scw PDB file : Tito_Scwrl_1T6A.pdb: