Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKGNEAEVIQIMSTNPMHFLHPDISPGQKLKLNV 4U6U Chain:A ((21-35)) -------------------------------------------------FVPQAFVDILLSSFQ------

General information: TITO was launched using: RESULT: Template: 4U6U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -274 -137.00 -18.27 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -137.00 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.240

(partial model without unconserved sides chains): PDB file : Tito_4U6U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U6U-query.scw PDB file : Tito_Scwrl_4U6U.pdb: