Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNYEIFKAIHGLSHHNSVLDSIMVFITEYAIVAYALILLAIWLFGNTQSRKHVLYAGITGIAGLVINYLITLVYFEPRPFVAHTVHTLIPHAADASFPSDHTTGALA---ISIAMLFRNRKIGWPLVIFGLLTGF--SRIWVGHHYPVDVLGSLVVAIIIGFLFFRFSDLLRPFVDLVVRIYEAIINKLTKKPTDQNF 4PX7 Chain:A ((158-221)) -----------------------------------------------------------------------------------------------AFPSGHTMFAASWALLAVGLLWPRRRTLTIAILLVWATGVMGSRLLLGMHWPRD----LVVATLISW------------------------------------

General information: TITO was launched using: RESULT: Template: 4PX7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 156 -28255 -181.12 -487.16 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -181.12 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.009

(partial model without unconserved sides chains): PDB file : Tito_4PX7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4PX7-query.scw PDB file : Tito_Scwrl_4PX7.pdb: