Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------VVQCGQVTQLMAPCMPYLSGAPGMTPYGICCNSLGVLNQLAAS---TADRVAACNCVKAAASG----FPAVDFSRAAALPAACGL--AINFAVTPNMDCNQVTDEP---------------------------------------------------------------------------------------
2A35 Chain:A ((4-215))TPKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLD------NPVGPLAELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSSIFYNRVKGELEQALQEQGWPQLTIARPSLLFGPREEFRLAEILAAPIAGKYHGIEACDLARALWRLALEEGKGVRFVESDELRKLGKGS


General information:
TITO was launched using:
RESULT:

Template: 2A35.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -29417 for 474 contacts (-62.1/contact) +
2D Compatibility (PS) -9567 + (NN) -1952 + (LL) 96
1D Compatibility (HY) -2000 + (ID) 950
Total energy: -43790.0 ( -92.38 by residue)
QMean score : 0.284

(partial model without unconserved sides chains):
PDB file : Tito_2A35.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2A35-query.scw
PDB file : Tito_Scwrl_2A35.pdb: