Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceLTCGQVAGDLAACLPYLQGSGPLGSCCGGVRALLGAAKTPADRK-TACTCLKSAANAIKGINLSKAAGLPTACGVNIPYKISPSTDCSTVQ-----
4HLB Chain:A ((21-115))-DSDRFTAFEEELLARYADKGIRSVDVAAYAKGIDIVFVAADRKMTRAEFSAIASRSIRELKERFGFDKDVPIGAVLDYKKDAATDTRTRFVLKLR


General information:
TITO was launched using:
RESULT:

Template: 4HLB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -11454 for 549 contacts (-20.9/contact) +
2D Compatibility (PS) -9409 + (NN) -3713 + (LL) 176
1D Compatibility (HY) 400 + (ID) 750
Total energy: -24750.0 ( -45.08 by residue)
QMean score : 0.180

(partial model without unconserved sides chains):
PDB file : Tito_4HLB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4HLB-query.scw
PDB file : Tito_Scwrl_4HLB.pdb: