Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------QSCPQTIT----FSPCLTNVGNTGTP----------PAYDSQCCKLVRDPKWTDQCLCAVVSSHFPGVDETKALNLAHDCGRRVPKGIYCDGRPVPP--
1S6D Chain:A ((1-103))PYGRGRTESGCYQQMEEAEMLNHCGMYLMKNLGERSQVSPRMREEDHKQLCCMQLKNLD--EKCMCPAIMMMLNEPMWIRMRDQVMSMAHNLPIE--CNLMSQPCQM


General information:
TITO was launched using:
RESULT:

Template: 1S6D.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -17216 for 563 contacts (-30.6/contact) +
2D Compatibility (PS) -7978 + (NN) -4258 + (LL) 504
1D Compatibility (HY) -3200 + (ID) 500
Total energy: -32648.0 ( -57.99 by residue)
QMean score : 0.295

(partial model without unconserved sides chains):
PDB file : Tito_1S6D.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1S6D-query.scw
PDB file : Tito_Scwrl_1S6D.pdb: