Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
3SRU Chain:X ((2-158))-TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-


General information:
TITO was launched using:
RESULT:

Template: 3SRU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -126425 for 1172 contacts (-107.9/contact) +
2D Compatibility (PS) -16636 + (NN) -4802 + (LL) 272
1D Compatibility (HY) -24000 + (ID) 7850
Total energy: -179441.0 ( -153.11 by residue)
QMean score : 0.596

(partial model without unconserved sides chains):
PDB file : Tito_3SRU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3SRU-query.scw
PDB file : Tito_Scwrl_3SRU.pdb: