Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK 3MK7 Chain:A ((210-263)) ------VGFFLTAGFLGIMYYFV-PKQAERPVY--SYRLSIVHFWALITVYIWA-GPHHLHYTA------------------------

General information: TITO was launched using: RESULT: Template: 3MK7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 61 -15570 -255.24 -288.32 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -255.24 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.061

(partial model without unconserved sides chains): PDB file : Tito_3MK7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MK7-query.scw PDB file : Tito_Scwrl_3MK7.pdb: