Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL 2LS4 Chain:A ((6-21)) ---------------------------------------------------CIAVAAGAGTGYFLFS---------------

General information: TITO was launched using: RESULT: Template: 2LS4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 12 -906 -75.50 -56.63 target 2D structure prediction score : 0.13 Monomeric hydrophicity matching model chain A : 0.43 3D Compatibility (PKB) : -75.50 2D Compatibility (Sec. Struct. Predict.) : 0.13 1D Compatibility (Hydrophobicity) : 0.43 QMean score : -0.162

(partial model without unconserved sides chains): PDB file : Tito_2LS4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LS4-query.scw PDB file : Tito_Scwrl_2LS4.pdb: