Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 2HUE Chain:A ((113-156)) -----------------VRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFN-----------

General information: TITO was launched using: RESULT: Template: 2HUE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 84 -206 -2.45 -4.67 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -2.45 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.067

(partial model without unconserved sides chains): PDB file : Tito_2HUE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HUE-query.scw PDB file : Tito_Scwrl_2HUE.pdb: