Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKIRKILLSSALSFGMLISAVPALAAGTSSEVAVKNEEYDYDTIYRISPLPMDFQPTIEYNGYTYTLTRHYFDYSIGFYTAIYTKVV 2INY Chain:A ((749-763)) -----------------------------------------------------------YNGYRFWPDRHYFHY-------------

General information: TITO was launched using: RESULT: Template: 2INY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -1009 -504.25 -67.23 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain A : 0.48 3D Compatibility (PKB) : -504.25 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.48 QMean score : -0.007

(partial model without unconserved sides chains): PDB file : Tito_2INY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2INY-query.scw PDB file : Tito_Scwrl_2INY.pdb: