Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIEKLDKIEQNFK 1RZH Chain:H ((19-38)) -------------SFWIFLAGLIYYLQTEN-MRE------------------------------------

General information: TITO was launched using: RESULT: Template: 1RZH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 1 -600 -600.00 -30.00 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain H : 0.62 3D Compatibility (PKB) : -600.00 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.098

(partial model without unconserved sides chains): PDB file : Tito_1RZH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RZH-query.scw PDB file : Tito_Scwrl_1RZH.pdb: