Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF 4J2J Chain:D ((3-16)) -------------------------------------------RSVAVFPWHSLVPF

General information: TITO was launched using: RESULT: Template: 4J2J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 2 -956 -477.75 -68.25 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain D : 0.63 3D Compatibility (PKB) : -477.75 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.760

(partial model without unconserved sides chains): PDB file : Tito_4J2J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J2J-query.scw PDB file : Tito_Scwrl_4J2J.pdb: