Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTVMTVINSGYPTAH 3IUK Chain:A ((383-395)) --------------------------------------------TTTVFHEGVPGHH

General information: TITO was launched using: RESULT: Template: 3IUK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 12 -3 -0.25 -0.23 target 2D structure prediction score : 0.92 Monomeric hydrophicity matching model chain A : 0.39 3D Compatibility (PKB) : -0.25 2D Compatibility (Sec. Struct. Predict.) : 0.92 1D Compatibility (Hydrophobicity) : 0.39 QMean score : 0.419

(partial model without unconserved sides chains): PDB file : Tito_3IUK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IUK-query.scw PDB file : Tito_Scwrl_3IUK.pdb: