Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEDLLTNPLIIAAIIGIISAIFGKKSKEEKQNSQKRKKPQHVQSASPQKKQSKEDAPAPIPNRMEQARREAEERRRETARNLKGLERDLAAAKQKTVYTKQKMLQVNKDTVVQGIVLGEVFGPPRAKKPHRTMRPARKN 2LS4 Chain:A ((4-18)) -------YLCIAVAAGAGTGYF---------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2LS4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 5 -1341 -268.10 -89.37 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -268.10 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.550

(partial model without unconserved sides chains): PDB file : Tito_2LS4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LS4-query.scw PDB file : Tito_Scwrl_2LS4.pdb: