Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR-ENLERYLREQLGFEFKNAQ 487D Chain:N ((35-80)) --EAPLAIELDHDKVMNMQAKAEFYSEVLT----IVVDGKEIKVKAQDVQRH-------------

General information: TITO was launched using: RESULT: Template: 487D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 74 -9409 -127.14 -209.08 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain N : 0.73 3D Compatibility (PKB) : -127.14 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.123

(partial model without unconserved sides chains): PDB file : Tito_487D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-487D-query.scw PDB file : Tito_Scwrl_487D.pdb: