Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFL---VVIGIIIWNVIQGIKVLRAA 4LII Chain:A ((463-491)) --------------------------------------------------------------------------------GKGVIFYLRDKVVVGIVLWNIFNRMPIAR--

General information: TITO was launched using: RESULT: Template: 4LII.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 42 -13479 -320.93 -518.42 target 2D structure prediction score : 0.04 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -320.93 2D Compatibility (Sec. Struct. Predict.) : 0.04 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.850

(partial model without unconserved sides chains): PDB file : Tito_4LII.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4LII-query.scw PDB file : Tito_Scwrl_4LII.pdb: