Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLFFYPVHIWMKREFGRWNDTEKKRG 2A9H Chain:A ((100-119)) -----------------------------------------------------ITSYGLVFAAVATWFVGREQ----------

General information: TITO was launched using: RESULT: Template: 2A9H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -430 -215.00 -21.50 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -215.00 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.005

(partial model without unconserved sides chains): PDB file : Tito_2A9H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2A9H-query.scw PDB file : Tito_Scwrl_2A9H.pdb: