Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTFPQVLTIAGSDSGGGAGIQADIKTFQERRTFGMSVITAITAQNT--LGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVVRNIRLHNFPNLVIDPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKIT-TKAEIERAAKKIYDMGVKAVVIKGGHSEMT-EAADFYFDGVTAKWLTSERFDTPHTHGTGCTFSACIAAELAKGNSLLDSVMVAKEFISSAIKYPLGIGHGHGPTNHFAYRMEDGK
2I5B Chain:A ((3-267))--MHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLYPEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGGGKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAKEFITAAIKESFPLNQYVGPTKHSALRL----


General information:
TITO was launched using:
RESULT:

Template: 2I5B.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -126280 for 2386 contacts (-52.9/contact) +
2D Compatibility (PS) -28263 + (NN) -6869 + (LL) 180
1D Compatibility (HY) -17200 + (ID) 5950
Total energy: -184382.0 ( -77.28 by residue)
QMean score : 0.517

(partial model without unconserved sides chains):
PDB file : Tito_2I5B.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2I5B-query.scw
PDB file : Tito_Scwrl_2I5B.pdb: