Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNIANYTLKVK----GKTLLQDTDLHFSSGKINHVVGKNGVGKSQLAKDFLLN---N----SKRIG--R-D------------IRQNVSLISSSSN--IPNDVSKDFLLHFLSKKFD----A-KMIDKIAYLLNLDNID----GKVLIKNLSDGQKQKLKLLSFLLEDKNIIVLDEITNSLDKKTVIEIHGFLNKYIQENPEKIIINITHDLSDLKAIEGDYYIFNHQEIQQYHSVDKLIEVYINE
4FWI Chain:B ((5-254))IRVEDLRAVYLVREGTIKAADGISLDILENSVTAIVGESASGKSTIIEAMTKTLPPNGRILSGRVLYKGKDLLTMREEELRKIRWKEIALVPQAAQQSLNPTMKVIEHFKDTVEAHGVRWSHSELIEKASEKLRMVRLNPEAVLNSYPLQLSGGMKQRVLIALALLLDPVVLILDEPTSALDVLTQAHIIQLLKELKKMLK-ITLIFVTHDIAVAAELADKVAVIYGGNLVEYNSTFQIFK-----


General information:
TITO was launched using:
RESULT:

Template: 4FWI.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 855 15941 18.64 78.53
target 2D structure prediction score : 0.61
Monomeric hydrophicity matching model chain B : 0.66

3D Compatibility (PKB) : 18.64
2D Compatibility (Sec. Struct. Predict.) : 0.61
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.519

(partial model without unconserved sides chains):
PDB file : Tito_4FWI.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4FWI-query.scw
PDB file : Tito_Scwrl_4FWI.pdb: