Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK 2ZCZ Chain:B ((4-71)) -----NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE--

General information: TITO was launched using: RESULT: Template: 2ZCZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 273 -18356 -67.24 -269.93 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.95 3D Compatibility (PKB) : -67.24 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.95 QMean score : 0.691

(partial model without unconserved sides chains): PDB file : Tito_2ZCZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZCZ-query.scw PDB file : Tito_Scwrl_2ZCZ.pdb: