Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHDKEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNHDKEFYQEIGSKGGNARNND 3Q4N Chain:A ((127-174)) --------------------TDNEDIKFVYENLMKG----SRNHMRAFVRMLNNYGSNYTPQYISKEEYEEI---------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3Q4N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 55 -1445 -26.26 -30.09 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -26.26 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.557

(partial model without unconserved sides chains): PDB file : Tito_3Q4N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3Q4N-query.scw PDB file : Tito_Scwrl_3Q4N.pdb: